PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_531_iso_11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 310aa    MW: 35040.5 Da    PI: 9.6831
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_531_iso_11genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.62.5e-072469346
                                         SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                                         +WT+ E + + +a + + ++   +W ++a +++ g+t  +++  ++ 
  cra_locus_531_iso_11_len_1893_ver_3 24 KWTPAENKAFENALAVFDKDtpdRWQRVADMVP-GKTVLDVIRQYRE 69
                                         8********************************.*******999986 PP

2Myb_DNA-binding45.71.5e-14134178347
                                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
  cra_locus_531_iso_11_len_1893_ver_3 134 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 178
                                          8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.782073IPR017884SANT domain
SMARTSM007172.8E-92173IPR001005SANT/Myb domain
SuperFamilySSF466892.3E-112378IPR009057Homeodomain-like
CDDcd001671.10E-62470No hitNo description
PfamPF002493.1E-62469IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-13124183IPR009057Homeodomain-like
PROSITE profilePS5129421.59127183IPR017930Myb domain
SuperFamilySSF466898.97E-17129182IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-17130182IPR006447Myb domain, plants
SMARTSM007173.2E-13131181IPR001005SANT/Myb domain
PfamPF002495.6E-13134178IPR001005SANT/Myb domain
CDDcd001675.41E-11134179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MEILSPSSYS SNSSWLYEES KSTKWTPAEN KAFENALAVF DKDTPDRWQR VADMVPGKTV  60
LDVIRQYREL EDDVSSIEAG LVPLPGYNTT SPFTLEWGNG HGFDGLKINS YAPTGKRSSS  120
TRPSSDHERK KGVPWTEEEH KLFLMGLKKY GKGDWRNISR NFVITRTPTQ VASHAQKYFI  180
RQLSGGKDKR RASIHDITTV NINDNQIPSP ENRKPPASSS DNSSSQQQQQ RNPTTVHKIP  240
LQWRNQMMMN NNGAAAIMNF NMDHGNNVFM YSNGSQNPSY LGCQSMVFQM QSADQYPHAX  300
WGGGHRLPKX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1625901176RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015896949.11e-138PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-138DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A068UL311e-142A0A068UL31_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000780291e-132(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140